SCOP 1.63: Domain d1efnc_: 1efn C:

Lineage for d1efnc_ (1efn C:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.34: SH3-like barrel [50036] (12 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (24 proteins)

6. Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50049] (9 PDB entries)

8. Domain d1efnc_: 1efn C: [24466]
   Other proteins in same PDB: d1efnb_, d1efnd_
   complexed with pbm; mutant

Details for d1efnc_

PDB Entry: 1efn, 2.5 Å

PDB Description: hiv-1 nef protein in complex with r96i mutant fyn sh3 domain

SCOP Domain Sequences for d1efnc_:

Sequence; same for both SEQRES and ATOM records:

>d1efnc_ b.34.2.1 (C:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens)}
alfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv

Timeline for d1efnc_:

• d1efnc_ first appeared (with stable ids) in SCOP 1.55
  
• d1efnc_ appears in SCOP 1.61
  
• d1efnc_ appears in SCOP 1.65
  
• d1efnc_ appears in the current release, SCOPe 2.08