| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50049] (32 PDB entries) |
| Domain d1efnc_: 1efn C: [24466] Other proteins in same PDB: d1efnb_, d1efnd_ complexed with pbm; mutant |
PDB Entry: 1efn (more details), 2.5 Å
SCOPe Domain Sequences for d1efnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efnc_ b.34.2.1 (C:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
alfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv
Timeline for d1efnc_: