Lineage for d1c0wb3 (1c0w B:147-226)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372426Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 372434Family b.34.1.2: Iron-dependent regulator [50041] (2 proteins)
  6. 372435Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 372436Species Corynebacterium diphtheriae [TaxId:1717] [50043] (12 PDB entries)
  8. 372448Domain d1c0wb3: 1c0w B:147-226 [24454]
    Other proteins in same PDB: d1c0wa1, d1c0wa2, d1c0wb1, d1c0wb2, d1c0wc1, d1c0wc2, d1c0wd1, d1c0wd2

Details for d1c0wb3

PDB Entry: 1c0w (more details), 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain

SCOP Domain Sequences for d1c0wb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0wb3 b.34.1.2 (B:147-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
apgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlsh
ngkdvellddlahtirieel

SCOP Domain Coordinates for d1c0wb3:

Click to download the PDB-style file with coordinates for d1c0wb3.
(The format of our PDB-style files is described here.)

Timeline for d1c0wb3: