SCOP 1.55: Domain d1c0wb3: 1c0w B:147-226

Lineage for d1c0wb3 (1c0w B:147-226)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.34: SH3-like barrel [50036] (7 superfamilies)

4. Superfamily b.34.1: C-terminal domain of biotin and diphtheria toxin repressors [50037] (2 families)

5. Family b.34.1.2: Diphtheria toxin repressor (DtxR) [50041] (1 protein)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (7 PDB entries)

8. Domain d1c0wb3: 1c0w B:147-226 [24454]
   Other proteins in same PDB: d1c0wa1, d1c0wa2, d1c0wb1, d1c0wb2, d1c0wc1, d1c0wc2, d1c0wd1, d1c0wd2

Details for d1c0wb3

PDB Entry: 1c0w, 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain

SCOP Domain Sequences for d1c0wb3:

Sequence; same for both SEQRES and ATOM records:

>d1c0wb3 b.34.1.2 (B:147-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
apgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlsh
ngkdvellddlahtirieel

Timeline for d1c0wb3:

• d1c0wb3 appears in SCOP 1.57
  
• d1c0wb3 appears in the current release, SCOPe 2.08