Lineage for d1c0wb3 (1c0w B:147-226)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13048Superfamily b.34.1: C-terminal domain of biotin and diphtheria toxin repressors [50037] (2 families) (S)
  5. 13054Family b.34.1.2: Diphtheria toxin repressor (DtxR) [50041] (1 protein)
  6. 13055Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 13056Species Corynebacterium diphtheriae [TaxId:1717] [50043] (7 PDB entries)
  8. 13063Domain d1c0wb3: 1c0w B:147-226 [24454]
    Other proteins in same PDB: d1c0wa1, d1c0wa2, d1c0wb1, d1c0wb2, d1c0wc1, d1c0wc2, d1c0wd1, d1c0wd2

Details for d1c0wb3

PDB Entry: 1c0w (more details), 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain

SCOP Domain Sequences for d1c0wb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0wb3 b.34.1.2 (B:147-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
apgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlsh
ngkdvellddlahtirieel

SCOP Domain Coordinates for d1c0wb3:

Click to download the PDB-style file with coordinates for d1c0wb3.
(The format of our PDB-style files is described here.)

Timeline for d1c0wb3: