![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) ![]() the N-terminal domains of these repressors bind DNA |
![]() | Family b.34.1.2: FeoA-like [50041] (5 proteins) |
![]() | Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries) Uniprot P33120 |
![]() | Domain d1c0wb3: 1c0w B:147-226 [24454] Other proteins in same PDB: d1c0wa1, d1c0wa2, d1c0wb1, d1c0wb2, d1c0wc1, d1c0wc2, d1c0wd1, d1c0wd2 protein/DNA complex; complexed with co |
PDB Entry: 1c0w (more details), 3.2 Å
SCOPe Domain Sequences for d1c0wb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0wb3 b.34.1.2 (B:147-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} apgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlsh ngkdvellddlahtirieel
Timeline for d1c0wb3: