Lineage for d1c0wb3 (1c0w B:147-226)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782726Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 2782792Family b.34.1.2: FeoA-like [50041] (5 proteins)
  6. 2782793Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 2782794Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
    Uniprot P33120
  8. 2782810Domain d1c0wb3: 1c0w B:147-226 [24454]
    Other proteins in same PDB: d1c0wa1, d1c0wa2, d1c0wb1, d1c0wb2, d1c0wc1, d1c0wc2, d1c0wd1, d1c0wd2
    protein/DNA complex; complexed with co

Details for d1c0wb3

PDB Entry: 1c0w (more details), 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain
PDB Compounds: (B:) diphtheria toxin repressor

SCOPe Domain Sequences for d1c0wb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0wb3 b.34.1.2 (B:147-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
apgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlsh
ngkdvellddlahtirieel

SCOPe Domain Coordinates for d1c0wb3:

Click to download the PDB-style file with coordinates for d1c0wb3.
(The format of our PDB-style files is described here.)

Timeline for d1c0wb3: