PDB entry 1c0w

View 1c0w on RCSB PDB site
Description: crystal structure of the cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal binding sh-like domain
Class: gene regulation/DNA
Keywords: toxin repressor-DNA complex, metal binding sh-like domain, gene regulation/DNA complex
Deposited on 1999-07-22, released 2000-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.249
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c0wa1, d1c0wa2, d1c0wa3
  • Chain 'B':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c0wb1, d1c0wb2, d1c0wb3
  • Chain 'C':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c0wc1, d1c0wc2, d1c0wc3
  • Chain 'D':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c0wd1, d1c0wd2, d1c0wd3
  • Chain 'E':
    Compound: DNA (5'-d(p*ap*tp*tp*ap*gp*gp*tp*tp*ap*gp*cp*cp*tp*ap*cp*cp*cp*tp*ap*ap*t)-3')
  • Chain 'F':
    Compound: DNA (5'-d(p*ap*tp*tp*ap*gp*gp*tp*tp*ap*gp*gp*cp*tp*ap*cp*cp*cp*tp*ap*ap*t)-3')
  • Heterogens: CO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c0wA (A:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlk
    dvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftq
    lldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0wA (A:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlk
    dvsrspfgnpipgldelgvivqineifqvetdqftqlldavellddlahtiri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c0wB (B:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlk
    dvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftq
    lldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0wB (B:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlk
    dvsrspfgnpipgldelgvapgtrvidaatsmprkvrivqineifqvetdqftqlldadi
    rvgseveivdrdghitlshngkdvellddlahtirieel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c0wC (C:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlk
    dvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftq
    lldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0wC (C:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlk
    dvsrspfgnpipgldelgvivqineifqvetdqftqlldadirvellddlahtir
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1c0wD (D:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlk
    dvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftq
    lldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0wD (D:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlk
    dvsrspfgnpipgldelgvvqineifqvetdqftqlldadirvvellddlahtir
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.