| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
| Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
| Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) |
| Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries) Uniprot P33120 |
| Domain d1c0wa2: 1c0w A:65-140 [18417] Other proteins in same PDB: d1c0wa1, d1c0wa3, d1c0wb1, d1c0wb3, d1c0wc1, d1c0wc3, d1c0wd1, d1c0wd3 protein/DNA complex; complexed with co |
PDB Entry: 1c0w (more details), 3.2 Å
SCOPe Domain Sequences for d1c0wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0wa2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv
Timeline for d1c0wa2: