Lineage for d1c0wc2 (1c0w C:65-140)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 357894Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 357895Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 357896Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 357897Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 357898Species Corynebacterium diphtheriae [TaxId:1717] [47982] (15 PDB entries)
  8. 357925Domain d1c0wc2: 1c0w C:65-140 [18419]
    Other proteins in same PDB: d1c0wa1, d1c0wa3, d1c0wb1, d1c0wb3, d1c0wc1, d1c0wc3, d1c0wd1, d1c0wd3

Details for d1c0wc2

PDB Entry: 1c0w (more details), 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain

SCOP Domain Sequences for d1c0wc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0wc2 a.76.1.1 (C:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOP Domain Coordinates for d1c0wc2:

Click to download the PDB-style file with coordinates for d1c0wc2.
(The format of our PDB-style files is described here.)

Timeline for d1c0wc2: