SCOP 1.55: Domain d1g8jb_: 1g8j B:

Lineage for d1g8jb_ (1g8j B:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)

4. Superfamily b.33.1: ISP domain [50022] (2 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins)

6. Protein Arsenite oxidase Rieske subunit [50029] (1 species)
7. Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries)
8. Domain d1g8jb_: 1g8j B: [24439]
   Other proteins in same PDB: d1g8ja1, d1g8ja2, d1g8jc1, d1g8jc2

Details for d1g8jb_

PDB Entry: 1g8j, 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8jb_:

Sequence; same for both SEQRES and ATOM records:

>d1g8jb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis}
ypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlcthmgc
ptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavgvdgli
ygrqanvi

SCOP Domain Coordinates for d1g8jb_ are not available.

Timeline for d1g8jb_:

• d1g8jb_ appears in SCOP 1.57
  
• d1g8jb_ appears in the current release, SCOPe 2.08