Lineage for d2wvhe2 (2wvh E:188-362)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2863020Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2863021Protein automated matches [190312] (14 species)
    not a true protein
  7. 2863135Species Zymomonas mobilis [TaxId:542] [255669] (6 PDB entries)
  8. 2863160Domain d2wvhe2: 2wvh E:188-362 [244332]
    Other proteins in same PDB: d2wvha1, d2wvha3, d2wvhb1, d2wvhb3, d2wvhe1, d2wvhe3, d2wvhf1, d2wvhf3, d2wvhv1, d2wvhv3, d2wvhx1, d2wvhx3, d2wvhy1, d2wvhy3, d2wvhz1, d2wvhz3
    automated match to d1zpda1

Details for d2wvhe2

PDB Entry: 2wvh (more details), 2.3 Å

PDB Description: structural insights into the pre-reaction state of pyruvate decarboxylase from zymomonas mobilis
PDB Compounds: (E:) pyruvate decarboxylase

SCOPe Domain Sequences for d2wvhe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wvhe2 c.31.1.0 (E:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadps

SCOPe Domain Coordinates for d2wvhe2:

Click to download the PDB-style file with coordinates for d2wvhe2.
(The format of our PDB-style files is described here.)

Timeline for d2wvhe2: