| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
| Protein automated matches [190312] (14 species) not a true protein |
| Species Zymomonas mobilis [TaxId:542] [255669] (6 PDB entries) |
| Domain d2wvhv2: 2wvh V:188-362 [244338] Other proteins in same PDB: d2wvha1, d2wvha3, d2wvhb1, d2wvhb3, d2wvhe1, d2wvhe3, d2wvhf1, d2wvhf3, d2wvhv1, d2wvhv3, d2wvhx1, d2wvhx3, d2wvhy1, d2wvhy3, d2wvhz1, d2wvhz3 automated match to d1zpda1 |
PDB Entry: 2wvh (more details), 2.3 Å
SCOPe Domain Sequences for d2wvhv2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wvhv2 c.31.1.0 (V:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadps
Timeline for d2wvhv2: