![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255658] (2 PDB entries) |
![]() | Domain d2wrdc1: 2wrd C:8-324 [244236] Other proteins in same PDB: d2wrda2, d2wrdb2, d2wrdc2 automated match to d1ha0a1 |
PDB Entry: 2wrd (more details), 3 Å
SCOPe Domain Sequences for d2wrdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrdc1 b.19.1.0 (C:8-324) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]} cigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllg npecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwt qhtttggsracavsgnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpide keqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinfest gnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpk yvkseklvlatglrnvp
Timeline for d2wrdc1:
![]() Domains from other chains: (mouse over for more information) d2wrda1, d2wrda2, d2wrdb1, d2wrdb2 |