Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255659] (2 PDB entries) |
Domain d2wrdb2: 2wrd B:330-494 [244235] Other proteins in same PDB: d2wrda1, d2wrdb1, d2wrdc1 automated match to d1ha0a2 |
PDB Entry: 2wrd (more details), 3 Å
SCOPe Domain Sequences for d2wrdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrdb2 h.3.1.0 (B:330-494) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]} glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeee
Timeline for d2wrdb2:
View in 3D Domains from other chains: (mouse over for more information) d2wrda1, d2wrda2, d2wrdc1, d2wrdc2 |