SCOPe 2.08: Domain d2wrdc2: 2wrd C:330-493

Lineage for d2wrdc2 (2wrd C:330-493)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255659] (2 PDB entries)

8. Domain d2wrdc2: 2wrd C:330-493 [244237]
   Other proteins in same PDB: d2wrda1, d2wrdb1, d2wrdc1
   automated match to d1ha0a2

Details for d2wrdc2

PDB Entry: 2wrd, 3 Å

PDB Description: structure of h2 japan hemagglutinin

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2wrdc2:

Sequence; same for both SEQRES and ATOM records:

>d2wrdc2 h.3.1.0 (C:330-493) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyee

Timeline for d2wrdc2:

• d2wrdc2 first appeared in SCOPe 2.04
  
• d2wrdc2 appears in SCOPe 2.07