Lineage for d2wrdb1 (2wrd B:5-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776331Species Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255658] (2 PDB entries)
  8. 2776336Domain d2wrdb1: 2wrd B:5-325 [244234]
    Other proteins in same PDB: d2wrda2, d2wrdb2, d2wrdc2
    automated match to d1ha0a1

Details for d2wrdb1

PDB Entry: 2wrd (more details), 3 Å

PDB Description: structure of h2 japan hemagglutinin
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2wrdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrdb1 b.19.1.0 (B:5-325) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]}
dqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagw
llgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkd
rwtqhtttggsracavsgnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhp
idekeqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinf
estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
cpkyvkseklvlatglrnvpq

SCOPe Domain Coordinates for d2wrdb1:

Click to download the PDB-style file with coordinates for d2wrdb1.
(The format of our PDB-style files is described here.)

Timeline for d2wrdb1: