Lineage for d2vzoa2 (2vzo A:226-335)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2762930Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries)
  8. 2762931Domain d2vzoa2: 2vzo A:226-335 [243967]
    Other proteins in same PDB: d2vzoa1, d2vzoa3, d2vzob1, d2vzob3
    automated match to d2vzsa1
    complexed with act, cd, gol

Details for d2vzoa2

PDB Entry: 2vzo (more details), 2.24 Å

PDB Description: crystal structure of amycolatopsis orientalis exo-chitosanase csxa
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzoa2 b.1.4.0 (A:226-335) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
avalrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvslaaker
ktvtfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvr

SCOPe Domain Coordinates for d2vzoa2:

Click to download the PDB-style file with coordinates for d2vzoa2.
(The format of our PDB-style files is described here.)

Timeline for d2vzoa2: