SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2vzoa4 (2vzo A:675-777)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2030012Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2030471Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2030472Protein automated matches [254633] (8 species)
    not a true protein
  7. 2030473Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries)
  8. 2030487Domain d2vzoa4: 2vzo A:675-777 [243969]
    Other proteins in same PDB: d2vzoa1, d2vzoa3, d2vzob1, d2vzob3
    automated match to d2vzsa3
    complexed with act, cd, gol

Details for d2vzoa4

PDB Entry: 2vzo (more details), 2.24 Å

PDB Description: crystal structure of amycolatopsis orientalis exo-chitosanase csxa
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzoa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzoa4 b.1.4.0 (A:675-777) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
plhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntktglsvgalgakatav
tvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwg

SCOPe Domain Coordinates for d2vzoa4:

Click to download the PDB-style file with coordinates for d2vzoa4.
(The format of our PDB-style files is described here.)

Timeline for d2vzoa4: