Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Amycolatopsis orientalis [TaxId:31958] [255631] (4 PDB entries) |
Domain d2vzoa3: 2vzo A:336-674 [243968] Other proteins in same PDB: d2vzoa1, d2vzoa2, d2vzoa4, d2vzoa5, d2vzob1, d2vzob2, d2vzob4, d2vzob5 automated match to d2vzsa5 complexed with act, cd, gol |
PDB Entry: 2vzo (more details), 2.24 Å
SCOPe Domain Sequences for d2vzoa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzoa3 c.1.8.0 (A:336-674) automated matches {Amycolatopsis orientalis [TaxId: 31958]} dvkatlnssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleg hiepdeffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerl rdhpsvisfhigsefapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngp ydyvppvywydksqkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqy hrsssdtfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnp stgliywmlnspwtslhwqlfdaymdqngayygakkane
Timeline for d2vzoa3: