Lineage for d2vzoa1 (2vzo A:49-225)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2774973Species Amycolatopsis orientalis [TaxId:31958] [255629] (4 PDB entries)
  8. 2774974Domain d2vzoa1: 2vzo A:49-225 [243966]
    Other proteins in same PDB: d2vzoa2, d2vzoa3, d2vzoa4, d2vzoa5, d2vzob2, d2vzob3, d2vzob4, d2vzob5
    automated match to d2vzsa4
    complexed with act, cd, gol

Details for d2vzoa1

PDB Entry: 2vzo (more details), 2.24 Å

PDB Description: crystal structure of amycolatopsis orientalis exo-chitosanase csxa
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzoa1 b.18.1.0 (A:49-225) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
gnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystn
mqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytr
hdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsg

SCOPe Domain Coordinates for d2vzoa1:

Click to download the PDB-style file with coordinates for d2vzoa1.
(The format of our PDB-style files is described here.)

Timeline for d2vzoa1: