SCOPe 2.04: Domain d2rqsa_: 2rqs A:

Lineage for d2rqsa_ (2rqs A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (20 species)
   not a true protein

7. Species Cenarchaeum symbiosum [TaxId:46770] [255473] (2 PDB entries)

8. Domain d2rqsa_: 2rqs A: [243753]
   automated match to d3ui4a_

Details for d2rqsa_

PDB Entry: 2rqs

PDB Description: 3D structure of Pin from the psychrophilic archeon Cenarcheaum symbiosum (CsPin)

PDB Compounds: (A:) Parvulin-like peptidyl-prolyl isomerase

SCOPe Domain Sequences for d2rqsa_:

Sequence; same for both SEQRES and ATOM records:

>d2rqsa_ d.26.1.0 (A:) automated matches {Cenarchaeum symbiosum [TaxId: 46770]}
gpmgsmadkikcshilvkkqgealavqerlkagekfgklakelsidggsakrdgslgyfg
rgkmvkpfedaafrlqvgevsepvksefgyhvikrlg

Timeline for d2rqsa_:

• d2rqsa_ is new in SCOPe 2.04-stable
  
• d2rqsa_ appears in SCOPe 2.05
  
• d2rqsa_ appears in the current release, SCOPe 2.08, called d2rqsa1