Lineage for d2rqsa1 (2rqs A:6-97)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941729Species Cenarchaeum symbiosum [TaxId:46770] [255473] (2 PDB entries)
  8. 2941731Domain d2rqsa1: 2rqs A:6-97 [243753]
    Other proteins in same PDB: d2rqsa2
    automated match to d3ui4a_

Details for d2rqsa1

PDB Entry: 2rqs (more details)

PDB Description: 3D structure of Pin from the psychrophilic archeon Cenarcheaum symbiosum (CsPin)
PDB Compounds: (A:) Parvulin-like peptidyl-prolyl isomerase

SCOPe Domain Sequences for d2rqsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rqsa1 d.26.1.0 (A:6-97) automated matches {Cenarchaeum symbiosum [TaxId: 46770]}
madkikcshilvkkqgealavqerlkagekfgklakelsidggsakrdgslgyfgrgkmv
kpfedaafrlqvgevsepvksefgyhvikrlg

SCOPe Domain Coordinates for d2rqsa1:

Click to download the PDB-style file with coordinates for d2rqsa1.
(The format of our PDB-style files is described here.)

Timeline for d2rqsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rqsa2