SCOPe 2.08: Domain d2r52a_: 2r52 A:

Lineage for d2r52a_ (2r52 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein automated matches [190307] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187121] (9 PDB entries)

8. Domain d2r52a_: 2r52 A: [243655]
   automated match to d1tgja_
   complexed with ipa

Details for d2r52a_

PDB Entry: 2r52, 2.5 Å

PDB Description: Crystal structure analysis of Bone Morphogenetic Protein-6 (BMP-6)

PDB Compounds: (A:) Bone morphogenetic protein 6

SCOPe Domain Sequences for d2r52a_:

Sequence; same for both SEQRES and ATOM records:

>d2r52a_ g.17.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktacrkhelyvsfqdlgwqdwiiapkgyaanycdgecsfplnahmnatnhaivqtlvhlm
npeyvpkpccaptklnaisvlyfddnsnvilkkyrnmvvracgch

Timeline for d2r52a_:

• d2r52a_ first appeared in SCOPe 2.04
  
• d2r52a_ appears in SCOPe 2.07