Lineage for d2r52b_ (2r52 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033672Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 3033789Protein automated matches [190307] (2 species)
    not a true protein
  7. 3033790Species Human (Homo sapiens) [TaxId:9606] [187121] (9 PDB entries)
  8. 3033802Domain d2r52b_: 2r52 B: [243656]
    automated match to d1tgja_
    complexed with ipa

Details for d2r52b_

PDB Entry: 2r52 (more details), 2.5 Å

PDB Description: Crystal structure analysis of Bone Morphogenetic Protein-6 (BMP-6)
PDB Compounds: (B:) Bone morphogenetic protein 6

SCOPe Domain Sequences for d2r52b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r52b_ g.17.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktacrkhelyvsfqdlgwqdwiiapkgyaanycdgecsfplnahmnatnhaivqtlvhlm
npeyvpkpccaptklnaisvlyfddnsnvilkkyrnmvvracgch

SCOPe Domain Coordinates for d2r52b_:

Click to download the PDB-style file with coordinates for d2r52b_.
(The format of our PDB-style files is described here.)

Timeline for d2r52b_: