Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (20 species) not a true protein |
Species Caulobacter vibrioides [TaxId:190650] [255551] (1 PDB entry) |
Domain d2q01b_: 2q01 B: [243511] automated match to d3iaca_ complexed with k |
PDB Entry: 2q01 (more details), 2.34 Å
SCOPe Domain Sequences for d2q01b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q01b_ c.1.9.0 (B:) automated matches {Caulobacter vibrioides [TaxId: 190650]} rplsfhedrlfpsdpatrsyarglyalvkdlpiisphghtdpswfatnapfqdatdllla pdhylfrmlysqgvsldalkvrskagvpdtdpreawrvfashfylfrgtpswvwlnhvfs qvfgftefleasnaddyfdritaalatdafrpralfdrfnietlattegpheslqhhaai resgwgghvitayrpdavidfederspraferfaetsgqdvyswksyleahrlrrqafid agatssdhghptaatadlsdveaealfnslvkgdvtpekaelfraqmltemakmslddgl vmqihpgshrnhnvgllnshgrdkgadipmrteyvdalkplltrlgndprlsiilftlde ttysrelaplaghypvlklgpswwfhdspegmmrfreqvtetagfyntvgfnddtrafls iparhdvarrvdsaflarmvaehrmdlveaeelivdltynlpkkaykldqrpdwarpatl
Timeline for d2q01b_: