Lineage for d2q01b_ (2q01 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084960Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2084961Protein automated matches [190150] (26 species)
    not a true protein
  7. 2084978Species Caulobacter vibrioides [TaxId:190650] [255551] (1 PDB entry)
  8. 2084980Domain d2q01b_: 2q01 B: [243511]
    automated match to d3iaca_
    complexed with k

Details for d2q01b_

PDB Entry: 2q01 (more details), 2.34 Å

PDB Description: Crystal structure of glucuronate isomerase from Caulobacter crescentus
PDB Compounds: (B:) uronate isomerase

SCOPe Domain Sequences for d2q01b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q01b_ c.1.9.0 (B:) automated matches {Caulobacter vibrioides [TaxId: 190650]}
rplsfhedrlfpsdpatrsyarglyalvkdlpiisphghtdpswfatnapfqdatdllla
pdhylfrmlysqgvsldalkvrskagvpdtdpreawrvfashfylfrgtpswvwlnhvfs
qvfgftefleasnaddyfdritaalatdafrpralfdrfnietlattegpheslqhhaai
resgwgghvitayrpdavidfederspraferfaetsgqdvyswksyleahrlrrqafid
agatssdhghptaatadlsdveaealfnslvkgdvtpekaelfraqmltemakmslddgl
vmqihpgshrnhnvgllnshgrdkgadipmrteyvdalkplltrlgndprlsiilftlde
ttysrelaplaghypvlklgpswwfhdspegmmrfreqvtetagfyntvgfnddtrafls
iparhdvarrvdsaflarmvaehrmdlveaeelivdltynlpkkaykldqrpdwarpatl

SCOPe Domain Coordinates for d2q01b_:

Click to download the PDB-style file with coordinates for d2q01b_.
(The format of our PDB-style files is described here.)

Timeline for d2q01b_: