Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) |
Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
Protein automated matches [190919] (11 species) not a true protein |
Species Staphylococcus aureus [TaxId:158879] [231089] (2 PDB entries) |
Domain d2p76e1: 2p76 E:44-309 [243452] Other proteins in same PDB: d2p76a2, d2p76b2, d2p76c2, d2p76d2, d2p76e2, d2p76f2, d2p76g2, d2p76h2 automated match to d2ooga_ complexed with gol, na |
PDB Entry: 2p76 (more details), 2.6 Å
SCOPe Domain Sequences for d2p76e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p76e1 c.1.18.0 (E:44-309) automated matches {Staphylococcus aureus [TaxId: 158879]} qwhtnltnerfttiahrgasgyapehtfqaydkshnelkasyieidlqrtkdghlvamhd etvnrttnghgkvedytldelkqldagswfnkkypkyarasyknakvptldeilerygpn anyyietkspdvypgmeeqllaslkkhhllnnnklknghvmiqsfsdeslkkihrqnkhv plvklvdkgelqqfndqrlkeirsyaiglgpdytdlteqnthhlkdlgfivhpytvneka dmlrlnkygvdgvftnfadkykevik
Timeline for d2p76e1: