SCOPe 2.07: Domain d2p76e1: 2p76 E:44-309

Lineage for d2p76e1 (2p76 E:44-309)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.0: automated matches [191539] (1 protein)
   not a true family

6. Protein automated matches [190919] (11 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [231089] (2 PDB entries)

8. Domain d2p76e1: 2p76 E:44-309 [243452]
   Other proteins in same PDB: d2p76a2, d2p76b2, d2p76c2, d2p76d2, d2p76e2, d2p76f2, d2p76g2, d2p76h2
   automated match to d2ooga_
   complexed with gol, na

Details for d2p76e1

PDB Entry: 2p76, 2.6 Å

PDB Description: crystal structure of a glycerophosphodiester phosphodiesterase from staphylococcus aureus

PDB Compounds: (E:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d2p76e1:

Sequence; same for both SEQRES and ATOM records:

>d2p76e1 c.1.18.0 (E:44-309) automated matches {Staphylococcus aureus [TaxId: 158879]}
qwhtnltnerfttiahrgasgyapehtfqaydkshnelkasyieidlqrtkdghlvamhd
etvnrttnghgkvedytldelkqldagswfnkkypkyarasyknakvptldeilerygpn
anyyietkspdvypgmeeqllaslkkhhllnnnklknghvmiqsfsdeslkkihrqnkhv
plvklvdkgelqqfndqrlkeirsyaiglgpdytdlteqnthhlkdlgfivhpytvneka
dmlrlnkygvdgvftnfadkykevik

Timeline for d2p76e1:

• d2p76e1 first appeared in SCOPe 2.04, called d2p76e_
  
• d2p76e1 appears in SCOPe 2.06
  
• d2p76e1 appears in the current release, SCOPe 2.08