![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) |
![]() | Protein Xylanase II [49979] (13 species) Partial overlap with common fold and the active sites of the other endoglucanases |
![]() | Species Aspergillus niger [49987] (1 PDB entry) |
![]() | Domain d1ukrd_: 1ukr D: [24339] |
PDB Entry: 1ukr (more details), 2.4 Å
SCOP Domain Sequences for d1ukrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukrd_ b.29.1.11 (D:) Xylanase II {Aspergillus niger} ginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysasg sasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsit gtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasvti s
Timeline for d1ukrd_: