Lineage for d1ukrd_ (1ukr D:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 295061Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 295092Protein Xylanase II [49979] (15 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 295095Species Aspergillus niger [49987] (1 PDB entry)
  8. 295099Domain d1ukrd_: 1ukr D: [24339]

Details for d1ukrd_

PDB Entry: 1ukr (more details), 2.4 Å

PDB Description: structure of endo-1,4-beta-xylanase c

SCOP Domain Sequences for d1ukrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukrd_ b.29.1.11 (D:) Xylanase II {Aspergillus niger}
ginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysasg
sasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsit
gtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasvti
s

SCOP Domain Coordinates for d1ukrd_:

Click to download the PDB-style file with coordinates for d1ukrd_.
(The format of our PDB-style files is described here.)

Timeline for d1ukrd_: