Class g: Small proteins [56992] (94 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.0: automated matches [191505] (1 protein) not a true family |
Protein automated matches [190829] (11 species) not a true protein |
Species Rhipicephalus microplus [TaxId:6941] [255526] (1 PDB entry) |
Domain d2odye2: 2ody E:81-142 [243319] automated match to d4dtgk_ complexed with na, nag, po4 |
PDB Entry: 2ody (more details), 2.35 Å
SCOPe Domain Sequences for d2odye2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2odye2 g.8.1.0 (E:81-142) automated matches {Rhipicephalus microplus [TaxId: 6941]} esadfktgcepaadsgscagqlerwfynvqsgecetfvyggcggndnnyeseeecelvck nm
Timeline for d2odye2: