SCOPe 2.06: Domain d2odye1: 2ody E:16-80

Lineage for d2odye1 (2ody E:16-80)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.0: automated matches [191505] (1 protein)
   not a true family

6. Protein automated matches [190829] (11 species)
   not a true protein

7. Species Rhipicephalus microplus [TaxId:6941] [255526] (1 PDB entry)

8. Domain d2odye1: 2ody E:16-80 [243318]
   automated match to d4dtgk_
   complexed with na, nag, po4

Details for d2odye1

PDB Entry: 2ody, 2.35 Å

PDB Description: thrombin-bound boophilin displays a functional and accessible reactive-site loop

PDB Compounds: (E:) Boophilin

SCOPe Domain Sequences for d2odye1:

Sequence; same for both SEQRES and ATOM records:

>d2odye1 g.8.1.0 (E:16-80) automated matches {Rhipicephalus microplus [TaxId: 6941]}
qrngfcrlpadegickaliprfyfntetgkctmfsyggcggnennfetieecqkacgape
rvndf

Timeline for d2odye1:

• d2odye1 first appeared in SCOPe 2.04
  
• d2odye1 appears in SCOPe 2.05
  
• d2odye1 appears in SCOPe 2.07
  
• d2odye1 appears in the current release, SCOPe 2.08