Lineage for d2odye2 (2ody E:81-142)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962426Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1962427Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1962693Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 1962694Protein automated matches [190829] (11 species)
    not a true protein
  7. 1962743Species Rhipicephalus microplus [TaxId:6941] [255526] (1 PDB entry)
  8. 1962745Domain d2odye2: 2ody E:81-142 [243319]
    automated match to d4dtgk_
    complexed with na, nag, po4

Details for d2odye2

PDB Entry: 2ody (more details), 2.35 Å

PDB Description: thrombin-bound boophilin displays a functional and accessible reactive-site loop
PDB Compounds: (E:) Boophilin

SCOPe Domain Sequences for d2odye2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odye2 g.8.1.0 (E:81-142) automated matches {Rhipicephalus microplus [TaxId: 6941]}
esadfktgcepaadsgscagqlerwfynvqsgecetfvyggcggndnnyeseeecelvck
nm

SCOPe Domain Coordinates for d2odye2:

Click to download the PDB-style file with coordinates for d2odye2.
(The format of our PDB-style files is described here.)

Timeline for d2odye2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2odye1