![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) |
![]() | Protein Xylanase II [49979] (13 species) Partial overlap with common fold and the active sites of the other endoglucanases |
![]() | Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries) |
![]() | Domain d1enxb_: 1enx B: [24326] |
PDB Entry: 1enx (more details), 1.5 Å
SCOP Domain Sequences for d1enxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1enxb_ b.29.1.11 (B:) Xylanase II {Trichoderma reesei, xynII} etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf ssgsasitvs
Timeline for d1enxb_: