| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries) |
| Domain d1enxb1: 1enx B:2-190 [24326] Other proteins in same PDB: d1enxa2, d1enxb2 |
PDB Entry: 1enx (more details), 1.5 Å
SCOPe Domain Sequences for d1enxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1enxb1 b.29.1.11 (B:2-190) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs
Timeline for d1enxb1: