| Class b: All beta proteins [48724] (176 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein Xylanase II [49979] (18 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries) |
| Domain d1qh7a_: 1qh7 A: [24317] complexed with xyp |
PDB Entry: 1qh7 (more details), 1.78 Å
SCOPe Domain Sequences for d1qh7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qh7a_ b.29.1.11 (A:) Xylanase II {Bacillus agaradhaerens [TaxId: 76935]}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplveyyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnpls
Timeline for d1qh7a_: