Lineage for d1qh7a_ (1qh7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780112Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries)
  8. 2780115Domain d1qh7a_: 1qh7 A: [24317]
    complexed with xyp

Details for d1qh7a_

PDB Entry: 1qh7 (more details), 1.78 Å

PDB Description: catalysis and specificity in enzymatic glycoside hydrolases: a 2,5b conformation for the glycosyl-enzyme intermidiate revealed by the structure of the bacillus agaradhaerens family 11 xylanase
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1qh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh7a_ b.29.1.11 (A:) Xylanase II {Bacillus agaradhaerens [TaxId: 76935]}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplveyyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnpls

SCOPe Domain Coordinates for d1qh7a_:

Click to download the PDB-style file with coordinates for d1qh7a_.
(The format of our PDB-style files is described here.)

Timeline for d1qh7a_: