SCOPe 2.05: Domain d1qh7a_: 1qh7 A:

Lineage for d1qh7a_ (1qh7 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (19 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus agaradhaerens [TaxId:76935] [49982] (4 PDB entries)

8. Domain d1qh7a_: 1qh7 A: [24317]
   complexed with xyp

Details for d1qh7a_

PDB Entry: 1qh7, 1.78 Å

PDB Description: catalysis and specificity in enzymatic glycoside hydrolases: a 2,5b conformation for the glycosyl-enzyme intermidiate revealed by the structure of the bacillus agaradhaerens family 11 xylanase

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1qh7a_:

Sequence; same for both SEQRES and ATOM records:

>d1qh7a_ b.29.1.11 (A:) Xylanase II {Bacillus agaradhaerens [TaxId: 76935]}
eivtdnsignhdgydyefwkdsggsgtmilnhggtfsaqwnnvnnilfrkgkkfnetqth
qqvgnmsinyganfqpngnaylcvygwtvdplveyyivdswgnwrppgatpkgtitvdgg
tydiyetlrvnqpsikgiatfkqywsvrrskrtsgtisvsnhfrawenlgmnmgkmyeva
ltvegyqssgsanvysntlringnpls

Timeline for d1qh7a_:

• d1qh7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qh7a_ appears in SCOPe 2.04
  
• d1qh7a_ appears in SCOPe 2.06
  
• d1qh7a_ appears in the current release, SCOPe 2.08