Lineage for d1c5ha_ (1c5h A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins) 
Protein Xylanase II [49979] (11 species) Species Bacillus circulans [TaxId:1397] [49980] (7 PDB entries) 
Domain d1c5ha_: 1c5h A: [24311]
Details for d1c5ha_
PDB Entry: 1c5h (more details), 1.55 Å
PDB Description: hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase
SCOP Domain Sequences for d1c5ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5ha_ b.29.1.11 (A:) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgdfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw
SCOP Domain Coordinates for d1c5ha_:
Click to download the PDB-style file with coordinates for d1c5ha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c5ha_:
- d1c5ha_ appears in SCOP 1.57
- d1c5ha_ appears in the current release, SCOPe 2.08
View in 3D