Class a: All alpha proteins [46456] (290 folds) |
Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) the 5th, C-terminal helix is missing in some of the member structures |
Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins) automatically mapped to Pfam PF00540 |
Protein automated matches [228657] (4 species) not a true protein |
Species Human immunodeficiency virus type 1 [TaxId:11698] [255469] (2 PDB entries) |
Domain d2lyba_: 2lyb A: [243036] automated match to d1upha_ complexed with 8sp |
PDB Entry: 2lyb (more details)
SCOPe Domain Sequences for d2lyba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lyba_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad tgnnsqvsqny
Timeline for d2lyba_: