SCOPe 2.04: Domain d2lyba_: 2lyb A:

Lineage for d2lyba_ (2lyb A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
   automatically mapped to Pfam PF00540

6. Protein automated matches [228657] (4 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11698] [255469] (2 PDB entries)

8. Domain d2lyba_: 2lyb A: [243036]
   automated match to d1upha_
   complexed with 8sp

Details for d2lyba_

PDB Entry: 2lyb

PDB Description: Structure of HIV-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidyl-L-serine

PDB Compounds: (A:) Matrix protein p17

SCOPe Domain Sequences for d2lyba_:

Sequence; same for both SEQRES and ATOM records:

>d2lyba_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
tgnnsqvsqny

Timeline for d2lyba_:

• d2lyba_ is new in SCOPe 2.04-stable
  
• d2lyba_ appears in SCOPe 2.05
  
• d2lyba_ appears in the current release, SCOPe 2.08