Lineage for d2lrlc_ (2lrl C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985866Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) (S)
  5. 1985876Family a.7.2.0: automated matches [191602] (1 protein)
    not a true family
  6. 1985877Protein automated matches [191097] (4 species)
    not a true protein
  7. 1985888Species Escherichia coli K-12 [TaxId:83333] [255453] (2 PDB entries)
  8. 1985891Domain d2lrlc_: 2lrl C: [242977]
    Other proteins in same PDB: d2lrld_
    automated match to d3l8ra_
    complexed with po3

Details for d2lrlc_

PDB Entry: 2lrl (more details)

PDB Description: Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose Branch of the Escherichia coli Phosphotransferase System
PDB Compounds: (C:) n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component

SCOPe Domain Sequences for d2lrlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lrlc_ a.7.2.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka

SCOPe Domain Coordinates for d2lrlc_:

Click to download the PDB-style file with coordinates for d2lrlc_.
(The format of our PDB-style files is described here.)

Timeline for d2lrlc_: