![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) ![]() |
![]() | Family a.7.2.0: automated matches [191602] (1 protein) not a true family |
![]() | Protein automated matches [191097] (4 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255453] (2 PDB entries) |
![]() | Domain d2lrlc_: 2lrl C: [242977] Other proteins in same PDB: d2lrld_ automated match to d3l8ra_ complexed with po3 |
PDB Entry: 2lrl (more details)
SCOPe Domain Sequences for d2lrlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lrlc_ a.7.2.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka
Timeline for d2lrlc_: