Class a: All alpha proteins [46456] (289 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) |
Family a.7.2.0: automated matches [191602] (1 protein) not a true family |
Protein automated matches [191097] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255453] (2 PDB entries) |
Domain d2lrla_: 2lrl A: [242975] Other proteins in same PDB: d2lrld_ automated match to d3l8ra_ complexed with po3 |
PDB Entry: 2lrl (more details)
SCOPe Domain Sequences for d2lrla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lrla_ a.7.2.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka
Timeline for d2lrla_: