SCOPe 2.02: Domain d1eg1a_: 1eg1 A:

Lineage for d1eg1a_ (1eg1 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold

6. Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)

7. Species Trichoderma reesei, Endoglucanase I [TaxId:51453] [68899] (1 PDB entry)

8. Domain d1eg1a_: 1eg1 A: [24290]
   CASP2
   complexed with nag

Details for d1eg1a_

PDB Entry: 1eg1, 3.6 Å

PDB Description: endoglucanase i from trichoderma reesei

PDB Compounds: (A:) endoglucanase I

SCOPe Domain Sequences for d1eg1a_:

Sequence; same for both SEQRES and ATOM records:

>d1eg1a_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Endoglucanase I [TaxId: 51453]}
eqpgtstpevhpklttykctksggcvaqdtsvvldwnyrwmhdanynsctvnggvnttlc
pdeatcgkncfiegvdyaasgvttsgssltmnqympsssggyssvsprlylldsdgeyvm
lklngqelsfdvdlsalpcgengslylsqmdengganqyntaganygsgycdaqcpvqtw
rngtlntshqgfccnemdilegnsranaltphsctatacdsagcgfnpygsgyksyygpg
dtvdtsktftiitqfntdngspsgnlvsitrkyqqngvdipsaqpggdtisscpsasayg
glatmgkalssgmvlvfsiwndnsqymnwldsgnagpcsstegnpsnilannpnthvvfs
nirwgdigstt

Timeline for d1eg1a_:

• d1eg1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1eg1a_ appears in SCOPe 2.01
  
• d1eg1a_ appears in SCOPe 2.03
  
• d1eg1a_ appears in the current release, SCOPe 2.08