Lineage for d1eg1a_ (1eg1 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308326Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 1308327Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)
  7. 1308374Species Trichoderma reesei, Endoglucanase I [TaxId:51453] [68899] (1 PDB entry)
  8. 1308375Domain d1eg1a_: 1eg1 A: [24290]
    CASP2
    complexed with nag

Details for d1eg1a_

PDB Entry: 1eg1 (more details), 3.6 Å

PDB Description: endoglucanase i from trichoderma reesei
PDB Compounds: (A:) endoglucanase I

SCOPe Domain Sequences for d1eg1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg1a_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Endoglucanase I [TaxId: 51453]}
eqpgtstpevhpklttykctksggcvaqdtsvvldwnyrwmhdanynsctvnggvnttlc
pdeatcgkncfiegvdyaasgvttsgssltmnqympsssggyssvsprlylldsdgeyvm
lklngqelsfdvdlsalpcgengslylsqmdengganqyntaganygsgycdaqcpvqtw
rngtlntshqgfccnemdilegnsranaltphsctatacdsagcgfnpygsgyksyygpg
dtvdtsktftiitqfntdngspsgnlvsitrkyqqngvdipsaqpggdtisscpsasayg
glatmgkalssgmvlvfsiwndnsqymnwldsgnagpcsstegnpsnilannpnthvvfs
nirwgdigstt

SCOPe Domain Coordinates for d1eg1a_:

Click to download the PDB-style file with coordinates for d1eg1a_.
(The format of our PDB-style files is described here.)

Timeline for d1eg1a_: