Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins) contains many insertions in the common fold |
Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species) |
Species Trichoderma reesei, Endoglucanase I [TaxId:51453] [68899] (1 PDB entry) |
Domain d1eg1c_: 1eg1 C: [24291] CASP2 complexed with nag |
PDB Entry: 1eg1 (more details), 3.6 Å
SCOPe Domain Sequences for d1eg1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eg1c_ b.29.1.10 (C:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Endoglucanase I [TaxId: 51453]} eqpgtstpevhpklttykctksggcvaqdtsvvldwnyrwmhdanynsctvnggvnttlc pdeatcgkncfiegvdyaasgvttsgssltmnqympsssggyssvsprlylldsdgeyvm lklngqelsfdvdlsalpcgengslylsqmdengganqyntaganygsgycdaqcpvqtw rngtlntshqgfccnemdilegnsranaltphsctatacdsagcgfnpygsgyksyygpg dtvdtsktftiitqfntdngspsgnlvsitrkyqqngvdipsaqpggdtisscpsasayg glatmgkalssgmvlvfsiwndnsqymnwldsgnagpcsstegnpsnilannpnthvvfs nirwgdigstt
Timeline for d1eg1c_: