Lineage for d2lh8a_ (2lh8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928689Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2928690Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2928691Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2928755Protein automated matches [191016] (9 species)
    not a true protein
  7. 2928760Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [255433] (1 PDB entry)
  8. 2928761Domain d2lh8a_: 2lh8 A: [242879]
    automated match to d1b10a_
    complexed with vib

Details for d2lh8a_

PDB Entry: 2lh8 (more details)

PDB Description: Syrian hamster prion protein with thiamine
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2lh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lh8a_ d.6.1.1 (A:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
lggymlgsamsrpmmhfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhdcvniti
kqhtvttttkgenftetdikimervveqmcttqyqkesqayydg

SCOPe Domain Coordinates for d2lh8a_:

Click to download the PDB-style file with coordinates for d2lh8a_.
(The format of our PDB-style files is described here.)

Timeline for d2lh8a_: