SCOPe 2.04: Domain d2lh8a_: 2lh8 A:

Lineage for d2lh8a_ (2lh8 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (6 species)
   not a true protein

7. Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [255433] (1 PDB entry)

8. Domain d2lh8a_: 2lh8 A: [242879]
   automated match to d1b10a_
   complexed with vib

Details for d2lh8a_

PDB Entry: 2lh8

PDB Description: Syrian hamster prion protein with thiamine

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2lh8a_:

Sequence; same for both SEQRES and ATOM records:

>d2lh8a_ d.6.1.1 (A:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
lggymlgsamsrpmmhfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhdcvniti
kqhtvttttkgenftetdikimervveqmcttqyqkesqayydg

Timeline for d2lh8a_:

• d2lh8a_ is new in SCOPe 2.04-stable
  
• d2lh8a_ appears in SCOPe 2.05
  
• d2lh8a_ appears in the current release, SCOPe 2.08