Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) |
Family d.6.1.1: Prion-like [54099] (3 proteins) |
Protein automated matches [191016] (6 species) not a true protein |
Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [255433] (1 PDB entry) |
Domain d2lh8a_: 2lh8 A: [242879] automated match to d1b10a_ complexed with vib |
PDB Entry: 2lh8 (more details)
SCOPe Domain Sequences for d2lh8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lh8a_ d.6.1.1 (A:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} lggymlgsamsrpmmhfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhdcvniti kqhtvttttkgenftetdikimervveqmcttqyqkesqayydg
Timeline for d2lh8a_: