SCOPe 2.08: Domain d2lc1a1: 2lc1 A:3-100

Lineage for d2lc1a1 (2lc1 A:3-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.0: automated matches [191616] (1 protein)
   not a true family

6. Protein automated matches [191125] (8 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [255424] (2 PDB entries)

8. Domain d2lc1a1: 2lc1 A:3-100 [242837]
   Other proteins in same PDB: d2lc1a2
   automated match to d3po8a_

Details for d2lc1a1

PDB Entry: 2lc1

PDB Description: Rv0020c_FHA Structure

PDB Compounds: (A:) Putative uncharacterized protein TB39.8

SCOPe Domain Sequences for d2lc1a1:

Sequence; same for both SEQRES and ATOM records:

>d2lc1a1 b.26.1.0 (A:3-100) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gsagtsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqvalla
dlnstngttvnnapvqewqladgdvirlghseiivrmh

Timeline for d2lc1a1:

• d2lc1a1 first appeared in SCOPe 2.04, called d2lc1a_
  
• d2lc1a1 appears in SCOPe 2.07