Class b: All beta proteins [48724] (176 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.0: automated matches [191616] (1 protein) not a true family |
Protein automated matches [191125] (6 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [255424] (1 PDB entry) |
Domain d2lc1a_: 2lc1 A: [242837] automated match to d3po8a_ |
PDB Entry: 2lc1 (more details)
SCOPe Domain Sequences for d2lc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lc1a_ b.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ghgsagtsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqval ladlnstngttvnnapvqewqladgdvirlghseiivrmh
Timeline for d2lc1a_: