SCOPe 2.04: Domain d2lc1a_: 2lc1 A:

Lineage for d2lc1a_ (2lc1 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.0: automated matches [191616] (1 protein)
   not a true family

6. Protein automated matches [191125] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [255424] (1 PDB entry)

8. Domain d2lc1a_: 2lc1 A: [242837]
   automated match to d3po8a_

Details for d2lc1a_

PDB Entry: 2lc1

PDB Description: Rv0020c_FHA Structure

PDB Compounds: (A:) Putative uncharacterized protein TB39.8

SCOPe Domain Sequences for d2lc1a_:

Sequence; same for both SEQRES and ATOM records:

>d2lc1a_ b.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ghgsagtsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqval
ladlnstngttvnnapvqewqladgdvirlghseiivrmh

Timeline for d2lc1a_:

• d2lc1a_ is new in SCOPe 2.04-stable
  
• d2lc1a_ appears in SCOPe 2.05
  
• d2lc1a_ appears in the current release, SCOPe 2.08, called d2lc1a1