SCOPe 2.08: Domain d2lb6a1: 2lb6 A:20-181

Lineage for d2lb6a1 (2lb6 A:20-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188249] (10 PDB entries)

8. Domain d2lb6a1: 2lb6 A:20-181 [242827]
   Other proteins in same PDB: d2lb6a2
   automated match to d1df3a_

Details for d2lb6a1

PDB Entry: 2lb6

PDB Description: structure of 18694da mup, typical to the major urinary protein family: mup9, mup11, mup15, mup18 & mup19

PDB Compounds: (A:) Major urinary protein 6

SCOPe Domain Sequences for d2lb6a1:

Sequence; same for both SEQRES and ATOM records:

>d2lb6a1 b.60.1.1 (A:20-181) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlenslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
grepdlssdikerfaqlceehgilreniidlsnanrclqare

Timeline for d2lb6a1:

• d2lb6a1 first appeared in SCOPe 2.04, called d2lb6a_
  
• d2lb6a1 appears in SCOPe 2.07